30-MINUTE MEALS! Get the email series now
Royal Recipe

Potato and Onion Cheese Pancakes

5 from 1 vote
1 Comments
Natalia Reed
By: Natalia ReedUpdated: Aug 6, 2026
This post may contain affiliate links. Please read our disclosure policy.

Crisp golden pancakes made from grated potatoes and onion, enriched with melted mozzarella and bright tomato dill topping for a comforting, quick meal.

Potato and Onion Cheese Pancakes

This potato and onion cheese pancake has been a weekday favorite in my kitchen since the first time I made it on a rainy Sunday when the pantry was lean and I wanted something warm and satisfying. It is the kind of dish that transforms simple pantry and fridge ingredients into something comforting and lively at the same time. The outside crisps to a deep golden brown while the inside stays tender and slightly creamy from the melted mozzarella. The grated onion gives a gentle sweetness and moisture that helps bind the potato when combined with egg, a touch of flour, and the reserved potato starch if needed. My family came in from errands hungry and left the table with smiles, which is the real test for any recipe I keep coming back to.

I discovered this combination while experimenting with latke-style pancakes but wanting a fresher, lighter finish. Adding shredded fresh mozzarella rather than a hard cheese yields soft pockets of melted dairy that marry beautifully with bright, diced tomatoes tossed with olive oil and dill. The tomatoes add acidity and freshness that cut through the richness, making the finished plate feel balanced rather than heavy. Because it is flexible, this dish is perfect for a casual lunch, an easy dinner, or a potluck contribution when you want something both familiar and a little unexpected.

Why You'll Love This Recipe

  • Quick to pull together using everyday ingredients, ready in about 45 minutes from start to finish without complicated steps or special equipment.
  • Hands-on technique is straightforward, with grating and gentle pressing delivering a crisp exterior and tender interior each time.
  • Uses pantry staples and a small amount of fresh produce, so it is budget friendly and approachable for novice cooks.
  • Make-ahead friendly since you can grate the vegetables and store the drained shreds refrigerated for up to 24 hours, or freeze formed patties for later frying.
  • Crowd-pleasing texture contrast, with melty cheese inside and bright tomato dill topping that makes it suitable for brunch or a light main course.
  • Customizable for dietary needs and seasonal produce, which means you can swap herbs or add a spice to suit your household.

In my experience this recipe wins over picky eaters because the cheese invites them in and the tomato topping makes each bite feel fresh. When I first served these, my partner asked for seconds before I even had a chance to sit down. Over time I have refined the draining and pressing technique to ensure the crispiest results, and I always reserve a little of the potato starch that settles after squeezing for better binding when the batter seems loose.

Ingredients

  • Onion: Use 1 medium yellow or sweet onion, freshly grated. Freshly grating releases juices that add flavor and moisture, but be sure to press out excess liquid so the pancakes crisp well. Look for firm onions with dry skins.
  • Potatoes: Four medium starchy potatoes, peeled and grated. Russet or Yukon gold are excellent because they provide good structure and brown well. If you prefer a waxy potato, expect a slightly less fluffy interior.
  • Eggs: Three large eggs at room temperature. Room temperature eggs mix more evenly into the batter and help with binding.
  • Flour: Four tablespoons all-purpose flour, about 1/4 cup. This amount keeps the mixture light while helping the pancakes hold their shape. If the batter is very wet add up to 1 tablespoon more.
  • Seasoning: Sea salt and freshly ground black pepper to taste. Salt brings out the natural sweetness of the onion and the starch in the potatoes.
  • Oil for frying: Three tablespoons olive oil, about 1 tablespoon per two pancakes. Choose a neutral olive oil or a light cooking oil for steady browning over medium heat.
  • Mozzarella: 5.3 ounces fresh mozzarella, shredded, about 1 1/3 cups packed. Fresh mozzarella melts into creamy pools inside each pancake.
  • Topping: Six ripe tomatoes diced and a small handful of fresh dill chopped. Toss with a tablespoon of olive oil and a pinch of salt for brightness.

Instructions

Grate and drain vegetables: Grate the potatoes and the onion using the large holes of a box grater or a food processor grating disc. Immediately transfer the potato shreds to a clean kitchen towel or cheesecloth, wrap, and twist to squeeze out as much liquid as possible. Reserve any settled potato starch that collects at the bottom of the bowl for extra binding; it can be stirred back in a tablespoon at a time if the mixture needs tightening. Proper draining is the single most important step for crisp edges. Combine ingredients: In a large mixing bowl combine the drained potatoes and onion with the eggs, flour, salt, pepper, shredded mozzarella, and about half of the chopped dill. Press a small handful together; it should cling and hold shape. If it falls apart or seems excessively wet add one tablespoon more flour and mix. Taste a tiny bit of the raw mixture for seasoning, adjusting salt and pepper as needed. Pan-fry pancakes: Heat a heavy skillet over medium heat and add about 1 tablespoon of oil for every two pancakes. Spoon roughly 3 heaping tablespoons of batter per pancake into the pan and use the back of the spoon to flatten each to a 3 to 4 inch round. Cook 3 to 4 minutes per side until the first side is deeply golden and the edges are crisp. Flip gently and cook the second side. Do not overcrowd the pan; give each pancake room to brown evenly. Keep warm and serve: Transfer cooked pancakes to a paper towel-lined plate to drain briefly, then keep warm on a wire rack in a 200 degrees Fahrenheit oven while you finish the batch. Toss the diced tomatoes with a tablespoon of olive oil, the remaining dill, a pinch of salt, and spoon over the hot pancakes just before serving so the tomatoes retain their fresh texture. Grated potatoes and onions ready for pressing

You Must Know

  • Draining the potato and onion thoroughly prevents soggy pancakes and encourages a deeply crisp exterior.
  • Reserving potato starch increases binding without adding more flour, preserving a light texture.
  • Maintain medium heat so the centers cook through without burning the outside; adjust the heat after the first batch if needed.
  • These keep well refrigerated for up to 3 days and freeze for up to 3 months if individually flash frozen on a tray before bagging.

My favorite part of this preparation is the contrast between the crunchy edge and the melty mozzarella inside. I often make a double batch for gatherings because everyone ends up sampling and asking for the recipe. Serving the tomatoes on top rather than mixing them in keeps the pancakes crisp and the tomatoes vibrant, which elevates the whole plate.

Finished potato pancakes stacked and topped with diced tomatoes

Storage Tips

Store cooled pancakes in an airtight container in the refrigerator for up to 3 days. To reheat while keeping the exterior crisp, place on a wire rack over a baking sheet and warm in a 350 degrees Fahrenheit oven for 8 to 12 minutes or until heated through. For longer storage freeze the cooled pancakes in a single layer on a tray until solid, then transfer to a freezer bag for up to 3 months. Reheat from frozen in a 375 degrees Fahrenheit oven for 12 to 18 minutes, flipping halfway, or pan-fry briefly in a skillet to restore crispness.

Ingredient Substitutions

If you want a gluten-free option replace the all-purpose flour with a cup-for-cup gluten-free flour blend or 3 tablespoons cornstarch plus 1 tablespoon rice flour to maintain crispness. For a dairy-free version omit the mozzarella and increase to 1 extra egg with 2 tablespoons nutritional yeast for savory depth. To add herbaceous complexity swap dill for chives or parsley, and add a pinch of smoked paprika if you like a subtle smoky note. Keep in mind that substituting cheeses will change melt and moisture levels so adjust flour by tablespoon increments as needed.

Serving Suggestions

These pancakes pair beautifully with a simple green salad dressed with lemon and olive oil for a light dinner or with a fried egg and avocado slices for a hearty brunch. For a Mediterranean twist serve alongside olives and a dollop of Greek yogurt. Garnish with extra fresh dill or chives and a squeeze of lemon for brightness. They also work well as a hand-held appetizer at parties if cut into smaller patties and served with toothpicks and a tangy yogurt-based dip.

Cultural Background

This preparation is inspired by Eastern European potato pancakes but leans lighter by incorporating fresh mozzarella and a bright tomato dill topping. Many regions have their version of grated potato cakes, from Jewish latkes to Polish placki ziemniaczane, and each tradition brings subtle differences in binding agents and accompaniments. Using fresh mozzarella and dill bridges those classic textures with a Mediterranean freshness that feels modern and approachable.

Seasonal Adaptations

In summer use the ripest tomatoes you can find and reduce added oil in the topping, letting tomato juices shine. In autumn swap dill for chopped sage and fold in a teaspoon of finely grated Parmesan for depth. For winter serve with roasted root vegetable salsa or braised greens for added warmth. Seasonal swaps keep the dish relevant year-round while showcasing local produce.

Meal Prep Tips

For meal prep, grate and drain the vegetables the evening before and store them tightly wrapped in the refrigerator. Form uncooked patties and layer parchment between them in a container or freeze them on a tray for quick pan-frying later. Label with the date and reheat straight from the fridge for breakfast or from frozen for a quick dinner. Use shallow, vented containers to avoid condensation and keep the edges crisp when reheating.

These pancakes are comforting, adaptable, and forgiving which is why I keep them in my weekly rotation. They bring together simple techniques and honest ingredients to create a meal that feels both new and familiar. Try making them for friends and notice how the small addition of fresh tomato and dill makes a big difference.

Pro Tips

  • Always squeeze out as much liquid as possible from the grated potatoes and onion to ensure crispy edges.

  • Reserve the potato starch that settles after squeezing and add a tablespoon if the mixture needs extra binding.

  • Cook over medium heat and adjust the temperature after the first batch to prevent burning while ensuring the centers cook through.

  • Use a wire rack in a warm 200 degrees Fahrenheit oven to keep pancakes crisp while finishing the rest of the batch.

This nourishing potato and onion cheese pancakes recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

FAQs about Recipes

Can I prepare the vegetables ahead of time?

Yes, you can prepare the grated and drained potatoes and onion up to 24 hours in advance, stored tightly wrapped in the refrigerator.

How do I freeze and reheat the pancakes?

Freeze formed uncooked patties on a tray until solid then transfer to a freezer bag. Reheat from frozen in a 375 degrees Fahrenheit oven for 12 to 18 minutes.

Tags

Easy Dinnersrecipespotatoonioncheesemozzarellaweeknightvegetarianpan-fried
No ratings yet

Potato and Onion Cheese Pancakes

This Potato and Onion Cheese Pancakes recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 4 steaks
Potato and Onion Cheese Pancakes
Prep:25 minutes
Cook:20 minutes
Rest Time:10 mins
Total:45 minutes

Ingredients

Main

Topping

Instructions

1

Grate and drain vegetables

Grate potatoes and onion using a box grater or grating disc. Transfer potato shreds to a clean towel, twist and squeeze out as much liquid as possible. Reserve any settled potato starch for optional use. Proper draining ensures crispy pancakes.

2

Combine ingredients

In a bowl mix drained potatoes and onion with eggs, flour, salt, pepper, shredded mozzarella and half the chopped dill. Press a small handful to test binding and add a tablespoon of flour or reserved starch if the batter is overly wet.

3

Pan-fry pancakes

Heat a skillet over medium heat with about 1 tablespoon oil per two pancakes. Spoon roughly 3 heaping tablespoons of batter per pancake and flatten to 3 to 4 inches. Fry 3 to 4 minutes per side until deep golden and crisp, adjusting heat as needed.

4

Keep warm and serve

Transfer cooked pancakes to a paper towel-lined plate, then keep warm on a wire rack in a 200 degrees Fahrenheit oven. Toss diced tomatoes with oil and remaining dill and serve atop pancakes just before serving.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 470kcal | Carbohydrates: 50g | Protein:
16g | Fat: 23g | Saturated Fat: 7g |
Polyunsaturated Fat: 5g | Monounsaturated Fat:
9g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@snapyrecipe on social media!

Potato and Onion Cheese Pancakes

Categories:

Potato and Onion Cheese Pancakes

Did You Make This?

Leave a comment & rating below or tag @snapyrecipe on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family Photo

Hi, I'm Natalia!

Chef and recipe creator specializing in delicious Easy Dinners cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

Get My 30-Minute Meals email series!

Quick and easy dinner ideas delivered to your inbox.