30-MINUTE MEALS! Get the email series now
Royal Recipe

Ham and Eggs Cups

5 from 1 vote
1 Comments
Natalia Reed
By: Natalia ReedUpdated: Apr 10, 2026
This post may contain affiliate links. Please read our disclosure policy.

Quick, protein-packed ham and eggs cups perfect for breakfast, meal prep, or a savory snack. Ready in under 25 minutes and effortless to customize.

Ham and Eggs Cups

This simple ham and eggs cups recipe has been a weekday lifesaver at my house. I first created it one busy morning while trying to get a hot protein-rich breakfast on the table before school drop-offs. The concept is wonderfully uncomplicated: deli ham forms a neat edible cup and holds softly cooked eggs, finished with a sprinkling of cheddar and black pepper. It’s the kind of dish that feels special but takes almost no thought, and it consistently gets enthusiastic thumbs up from family members who normally rush past the stove.

I love it because it delivers a balance of tender egg texture, salty ham edges that crisp just so, and a bit of melty cheese for comfort. I discovered that preparing the eggs slightly under-scrambled gives the best final texture once baked, because the oven finishes them without turning them rubbery. At Snapy Recipe I test simple ideas like this often, looking for minimal-ingredient successes that can become staples. These cups are adaptable, portable, and great for feeding different appetites at the same time.

Why You'll Love This Recipe

  • This takes about 20 minutes from start to finish, perfect for rushed mornings and last-minute brunch plans.
  • Uses pantry and fridge staples: deli ham, eggs, and shredded cheddar — no specialist shopping required.
  • Each portion is individually baked in a muffin tin, making serving and portion control effortless for families or meal prepping.
  • Make-ahead friendly: assemble the cups ahead and bake when needed, or bake and refrigerate for quick reheats.
  • Low-carb and high-protein, suitable for many dietary preferences with a few easy swaps.
  • Customizable: swap cheeses, add herbs, or fold in vegetables to change the profile without complicating steps.

I’ve made these more times than I can count. My partner will request them whenever we have guests staying over because they reheat well and look inviting on a simple platter. My kids enjoy the novelty of eating a mini cup they can hold, and I love the practicality: six servings from a single muffin tin, each exactly the right size for a satisfying breakfast portion.

Ingredients

  • 6 slices deli-style ham: Choose thin but sturdy slices that will form a cup when pressed into a muffin tin. Look for low-sodium varieties if you want less salt. Boar's Head or a good-quality local deli ham works well for flavor and texture.
  • 6 large eggs: Large eggs give consistent volume and cook predictably. Use eggs at room temperature for more even cooking if you have a few minutes to spare.
  • 1/2 cup shredded sharp cheddar cheese: Sharp cheddar adds tang and melts beautifully. Buy pre-shredded for convenience or shred a block for better melt and flavor. Measure loosely to fill 1/2 cup.
  • Black pepper, to taste: Freshly ground black pepper brightens the flavors. Add a light grind over each cup before baking for visual appeal and aroma.
  • Non-stick cooking spray: A light coating in the muffin cups prevents sticking and helps the ham edges crisp slightly. Alternatively, use a small brush of butter or oil.
User provided content image 2

Instructions

Preheat and prepare the pan:Set the oven to 375°F. Lightly coat a standard 6-cup muffin tin with non-stick cooking spray or brush each cavity with a small amount of oil. Position a rack in the center of the oven for even heat.Form the ham cups:Gently press one slice of deli ham into each muffin cavity, folding edges as needed to create a shallow cup. Leave the ham sitting so it lines the bottom and sides and will hold the eggs without collapsing. Slight overlaps are fine; they will crisp at the edges.Whisk and scramble the eggs:Crack the eggs into a bowl, season with a pinch of black pepper, and whisk until combined. Heat a non-stick skillet over medium and add a teaspoon of butter or oil. Pour the eggs into the pan and gently scramble, stopping when they are still slightly creamy — about 60 to 90 seconds of soft scrambling. This prevents overcooking once they bake.Fill the cups and add cheese:Divide the soft scrambled eggs evenly among the ham-lined cups. Sprinkle about one tablespoon of shredded cheddar on each filled cup, and finish with a light grind of black pepper. The cheese will melt and form an attractive top.Bake until set:Place the muffin tin in the preheated oven and bake 10 to 12 minutes. Look for melted cheese, lightly crisped ham edges, and egg that is set but still tender in the center. If your oven runs hot, check at 10 minutes to avoid overbrowning.Rest and remove:Take the tin out of the oven and let sit for 2 minutes so the cups firm up slightly. Use a small offset spatula or butter knife to gently lift each cup from its cavity. Serve warm or cool and refrigerate for later. User provided content image 1

You Must Know

  • These are high in protein and relatively low in carbohydrates, making them suitable for low-carb meal plans.
  • They store well in the refrigerator for up to 4 days and freeze solid cups for up to 3 months.
  • Reheat gently in a 325°F oven or microwave in short bursts to avoid rubbery eggs.
  • Quality of ham affects both texture and salt level. Choose a mild, minimally processed option for the best result.

My favorite part of this preparation is how forgiving it is. Even if you have uneven ham slices or slightly over-scrambled eggs, the oven will bring everything together. I remember making a double batch for a weekend brunch and neighbors kept dropping by for a quick plate. Each time someone took a bite, they’d comment on the balance of savory ham and creamy egg, which to me is the nicest compliment for such a simple dish.

Storage Tips

Store cooled cups in an airtight container in the refrigerator for up to four days. For longer storage, arrange cooled cups on a baking sheet to freeze solid, then transfer to a labeled freezer bag for up to three months. When reheating from frozen, thaw overnight in the refrigerator and warm in a 325°F oven until heated through, about 8 to 12 minutes. For quick reheats, microwave on medium power in 20 second intervals to maintain tender egg texture. Glass or BPA-free plastic containers with tight seals preserve moisture and prevent fridge odors from affecting flavor.

Ingredient Substitutions

If you want to swap ingredients, try turkey deli slices for lower fat and milder flavor. For a dairy-free option, omit the cheddar or use a plant-based shredded alternative that melts. If you prefer a more vegetable-forward cup, stir in a tablespoon of sautéed spinach or finely diced bell pepper per cup before baking. For extra richness, use half-and-half while scrambling eggs, about one tablespoon added to the whisked eggs, which increases creaminess but also calories. Keep in mind substitutions will change texture and cooking times slightly, so keep a close watch during the oven step.

Serving Suggestions

Serve warm with a side salad of baby greens tossed in lemon vinaigrette for a light lunch, or pair two cups with roasted potatoes for heartier brunch. Garnish with a sprinkle of chopped chives or parsley for color and a bright onion note. These are also convenient on a breakfast board with slices of avocado, a small dish of pickles, and sliced tomatoes. For a casual gathering, arrange on a platter with toothpicks inserted for easy grabbing.

Cultural Background

The idea of baking eggs in individual vessels has roots across many culinary traditions, from British baked eggs to French oeufs cocotte. Using cured or sliced meat as an edible mold taps into simple homestyle ingenuity seen in diners and family kitchens where convenience meets flavor. These cups are a modern, portable take on classic baked egg concepts, adapted for a faster pace and single-serve convenience popular in contemporary home cooking.

Seasonal Adaptations

Adapt the cups for spring by adding fresh herbs like chives and a tablespoon of blanched asparagus tips per cup. In summer, fold in sun-dried tomatoes and replace cheddar with a milder mozzarella. For autumn, include a small amount of caramelized onion and swap sharp cheddar for Gruyère for a deeper savory profile. Holiday versions can include chopped leftover ham from a roast and a pinch of nutmeg in the eggs for warmth and complexity.

Meal Prep Tips

To meal prep, assemble the cups without baking and cover tightly in the refrigerator for same-day baking. For a grab-and-go routine, bake a batch, cool completely, and portion into individual containers. When packing for work or school, include a small ice pack to keep them cool until reheating. Time-saving tip: scramble a double batch of eggs at once and cook in a wide skillet to speed filling multiple cups. Label containers with date and reheating instructions for family members.

These ham and eggs cups are modest but dependable. They are perfect for any morning you want something hot and satisfying without a lot of effort. Make them your own by experimenting with cheeses, herbs, and small vegetable additions, and enjoy the convenience of individual servings that reheat beautifully.

Pro Tips

  • Use room temperature eggs so they scramble more evenly and finish with a tender texture once baked.

  • Lightly spray the muffin tin to prevent the ham from sticking and to encourage crisp edges.

  • Stop scrambling the eggs while they are still slightly creamy; the oven will finish cooking them without drying out.

This nourishing ham and eggs cups recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

Tags

Lunch & Meal Prepbreakfasthameggsrecipeweekdaysprotein
No ratings yet

Ham and Eggs Cups

This Ham and Eggs Cups recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 6 steaks
Ham and Eggs Cups
Prep:8 minutes
Cook:12 minutes
Rest Time:10 mins
Total:20 minutes

Ingredients

Main Ingredients

Instructions

1

Preheat and prepare the pan

Preheat the oven to 375°F. Lightly coat a standard six-cup muffin tin with non-stick cooking spray or brush the cavities with a little oil so the ham will release easily after baking.

2

Form the ham cups

Press one slice of deli ham into each muffin cavity, folding and shaping the edges to create a cup that will hold the eggs. Ensure the ham covers the bottom and sides so the filling stays contained when baking.

3

Scramble the eggs

Crack the eggs into a bowl, whisk with a pinch of black pepper until blended. Heat a non-stick skillet over medium, add a small pat of butter or a teaspoon of oil, and gently scramble the eggs until still slightly creamy. This prevents overcooking during the bake.

4

Fill and top

Divide the soft scrambled eggs evenly among the ham cups. Sprinkle about one tablespoon of shredded cheddar on each and add a light grind of black pepper.

5

Bake and rest

Bake in the preheated oven for 10 to 12 minutes, until cheese is melted and ham edges are lightly crisp. Let rest in the tin for two minutes before removing to help the cups set.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 160kcal | Carbohydrates: 1g | Protein:
16g | Fat: 11g | Saturated Fat: 3g |
Polyunsaturated Fat: 2g | Monounsaturated Fat:
4g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@snapyrecipe on social media!

Ham and Eggs Cups

Categories:

Ham and Eggs Cups

Did You Make This?

Leave a comment & rating below or tag @snapyrecipe on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family Photo

Hi, I'm Natalia!

Chef and recipe creator specializing in delicious Lunch & Meal Prep cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

Get My 30-Minute Meals email series!

Quick and easy dinner ideas delivered to your inbox.