30-MINUTE MEALS! Get the email series now
Royal Recipe

Broccoli Cheese Pasta Recipe — A Creamy, Cheesy Delight

5 from 1 vote
1 Comments
Natalia Reed
By: Natalia ReedUpdated: Feb 10, 2026
This post may contain affiliate links. Please read our disclosure policy.

A quick and comforting pasta with tender broccoli and a bright, garlicky lemon cheese sauce that comes together in minutes and feels like a warm hug on a plate.

Broccoli Cheese Pasta Recipe — A Creamy, Cheesy Delight

This broccoli cheese pasta is the kind of recipe I make when I want something comforting that still feels fresh and lively. I first put these flavors together on a rainy weeknight when my fridge held pasta, two oversized heads of broccoli, and a small mound of leftover cheese. The bright zip of lemon with garlic and the salty glow of parmesan transformed simple pantry items into something that felt celebratory. The texture is creamy from the cheese with little pops of tender broccoli florets and the shells hold sauce in every nook.

I love how forgiving this dish is. It works with whatever short pasta you have, and the sauce lives in a jar which makes assembly both playful and precise. The lemon keeps the finish from feeling heavy while the olive oil and grated parmesan create a silky coating that clings to pasta without needing cream. Serve this when you want comfort without the guilt, or when friends drop by and you need something quick that still looks like an effort.

Why You'll Love This Recipe

  • Ready in around twenty minutes, perfect for busy weeknights when you want a satisfying meal without long prep.
  • Uses pantry staples and simple produce, making it very budget friendly and easy to shop for on short notice.
  • Bright lemon cuts through the richness so the dish never feels overly heavy, even with generous cheese.
  • Make ahead options for the sauce let you speed up assembly when cooking for a crowd, and leftovers reheat beautifully.
  • Flexible with cheeses and pasta shapes which means you can adapt to dietary needs or what is on hand.

My family always asks for this at the end of a busy week. One sibling calls it grown up mac and cheese because of the lemon and garlic lift. Over the years I adjusted the salt and the lemon balance to find the point where the dish sings, and each time I make it I think of that first rainy night when a few staples turned into dinner magic.

Ingredients

  • Short pasta, 12 ounces: Small shells or any short shape is ideal because the little curves catch bits of grated cheese and sauce. I often reach for small shells from store brands such as Barilla or De Cecco for reliable texture, and twelve ounces feeds three to four people depending on appetite.
  • Broccoli, two large heads: Look for bright green crowns with firm stalks. Cutting florets into small bite sized pieces helps them cook quickly and evenly, and they add a lively pop of color and nutrition to every forkful.
  • Shredded cheese, 1 cup: Use a good melting cheese such as sharp cheddar, young provolone, or a blend. Pre shredded cheese is convenient, but freshly shredded gives a silkier melt.
  • Grated parmesan, 1/3 cup: Finely grate for smooth integration into the sauce. Choose real parmesan or grana padano for a salty, nutty backbone.
  • Extra virgin olive oil, 5 tablespoons: This forms the body of the sauce. Use a fruity, good quality oil for the best aroma.
  • Lemon zest and juice, 2 teaspoons zest plus 2 tablespoons juice: Fresh lemon is essential. Zest adds volatile fragrant oils and juice brings bright acidity that lifts the whole dish.
  • Garlic, two cloves, minced: Fresh garlic gives welcome pungency. Mince fine so it disperses without leaving large raw pieces.
  • Seasonings: One teaspoon mixed dried herbs or one tablespoon fresh, one teaspoon sugar, three quarters teaspoon salt, half teaspoon black pepper, and half teaspoon red pepper flakes or more to taste for heat.

Instructions

Boil the pasta:Bring a large pot of water to a rolling boil and add two teaspoons salt. Add twelve ounces of short pasta and cook following package directions until just shy of al dente, usually about eight to ten minutes depending on the shape. Start testing a minute or two before the time listed to ensure a perfect bite.Prepare the broccoli:While the pasta cooks, trim and chop two large heads of broccoli into small florets and slice any thicker stalks into bite sized pieces. Smaller pieces cook quickly and blend into the dish more naturally.Cook the broccoli in the same pot:One to two minutes before the pasta is done, add the broccoli to the boiling water with the pasta. This blanches the broccoli so it is tender but still bright green. The brief cook keeps texture present and prevents mushiness. Scoop out a cup of the starchy pasta water before draining, reserve for the sauce.Assemble the sauce:Place lemon zest, lemon juice, five tablespoons olive oil, one third cup finely grated parmesan, two minced garlic cloves, one teaspoon mixed herbs, half teaspoon red pepper flakes or to taste, one teaspoon sugar, three quarters teaspoon salt, and half teaspoon black pepper in a jar with a tight fitting lid. Add half cup of reserved pasta water, close the lid and shake vigorously until the parmesan hydrates and the mixture looks emulsion like.Finish the dish:Drain the pasta and broccoli and return them to the pot off the heat. Pour the jarred sauce over the pasta, add one cup shredded cheese and stir briskly. The residual heat melts the cheese and the starch in the pasta water helps the sauce cling. Adjust with more reserved pasta water if the sauce needs loosening, and add salt or pepper to taste. Serve immediately with extra grated parmesan on top.User provided content image 1

You Must Know

  • This dish stores well chilled for up to three days in an airtight container and freezes for up to three months, though fresh cheese texture is best after refrigeration only.
  • One cup of reserved starchy pasta water is crucial, it helps emulsify the olive oil and cheese into a silky sauce.
  • High quality parmesan makes a big difference to flavor, and fresh lemon juice brightens the whole plate.
  • Vegetarian friendly but not dairy free, substitute nutritional yeast and olive oil to make a dairy free version.

My favorite part of this recipe is how quickly it becomes a family classic. On more than one occasion this dish has rescued an impromptu dinner party, drawing compliments for its balance of creamy and bright notes. Watching everyone reach for seconds feels like a small celebration each time, and the simplicity means I can chat with guests while everything finishes in one pot.

User provided content image 2

Storage Tips

Cool the pasta to room temperature within two hours and transfer to an airtight container. Refrigerate for up to three days. For longer keeping, portion into freezer safe containers and freeze for up to three months. To reheat refrigerated portions, warm gently in a skillet with a splash of water or olive oil over medium heat to restore creaminess. From frozen, thaw overnight in the refrigerator and reheat with a little extra lemon juice and olive oil to freshen the flavors. Avoid microwaving without liquid as cheese can separate or become grainy.

Ingredient Substitutions

If you do not have small shells, use elbow macaroni, rigatoni, or penne. For dairy free, substitute one quarter cup of nut based cheese or two tablespoons nutritional yeast plus additional oil for richness. Swap broccoli for broccolini or asparagus in spring, reducing cooking time for more tender stalks. To make it heartier, fold in cooked shredded chicken or chickpeas. If you prefer cream, stir in two tablespoons of heavy cream at the end for an extra silky texture, though the lemon brightens in a way cream will mute.

Serving Suggestions

Serve with an extra grating of parmesan and a light drizzle of olive oil. A crisp green salad with vinaigrette complements the richness, and crusty bread is perfect for mopping up any leftover sauce. For a more composed meal, pair the pasta with lemon roasted chicken or pan seared salmon. Garnish ideas include chopped fresh parsley for color, toasted pine nuts for crunch, or a scattering of lemon zest for amplified brightness.

Cultural Background

This combination draws on classic Italian influences where simple pantry ingredients and fresh produce are combined to create balanced comfort food. The use of olive oil, garlic, and parmesan echoes Italian pasta making, while the lemon shows the regional habit of adding brightness to cheese dishes. Though not a traditional Italian staple, it reflects modern home cooking which blends technique inspired by Italian cuisine with quick American weeknight sensibilities.

Seasonal Adaptations

In spring, swap broccoli for tender asparagus tips and add peas for sweetness. In late summer, stir in cherry tomatoes and basil for a fresher profile. Fall invites roasted squash or sautéed mushrooms folded into the pasta for earthier flavors. For winter, increase the amount of cheese and add roasted garlic to deepen the savoriness, which pairs well with shorter daylight and comfort food cravings.

Meal Prep Tips

Prepare the jarred sauce ahead and store refrigerated for up to two days to save time on busy nights. Blanch and shock the broccoli then store it separately to retain color and texture. Cook pasta to just under al dente when planning for reheating, that way it will not become mushy. Portion meals into microwave safe containers and include a small container of extra pasta water or olive oil so each portion can be refreshed when reheated.

Give this recipe a try on a regular weeknight and then again for guests. The approachable technique and bright, comforting flavor make it a repeat favorite that adapts easily to what you have on hand. Enjoy the small joys of a creamy, lemon kissed broccoli cheese plate that always feels like a homecoming.

Pro Tips

  • Reserve at least one cup of starchy pasta water before draining, use it gradually to create a silky sauce.

  • Use fresh lemon zest and juice for brightness, bottled lemon will not give the same aromatic lift.

  • Grate parmesan fresh for best texture, pre grated cheese can include anti caking agents that affect melting.

  • Add reserved pasta water in small amounts to adjust sauce consistency without diluting flavor.

  • If the sauce separates, whisk in a teaspoon of warm water slowly until it comes back together.

This nourishing broccoli cheese pasta recipe — a creamy, cheesy delight recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

Tags

Comfort Foodpastabroccolicheesecreamydinnerweeknightitalianrecipe
No ratings yet

Broccoli Cheese Pasta Recipe — A Creamy, Cheesy Delight

This Broccoli Cheese Pasta Recipe — A Creamy, Cheesy Delight recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 4 steaks
Broccoli Cheese Pasta Recipe — A Creamy, Cheesy Delight
Prep:10 minutes
Cook:12 minutes
Rest Time:10 mins
Total:22 minutes

Ingredients

Pasta and Vegetables

Sauce

Serving

Instructions

1

Boil pasta

Bring a large pot of water to a boil, add two teaspoons salt, then add twelve ounces of short pasta. Cook until just shy of al dente according to package time, testing a minute early for preferred bite.

2

Prepare broccoli

While pasta cooks, trim and chop two large heads of broccoli into small florets and slice any thick stalks into bite sized pieces so they cook evenly and blend with the pasta.

3

Blanch broccoli with pasta

Add the broccoli to the boiling pasta water one to two minutes before the pasta finishes to blanch it. Scoop out and reserve one cup of pasta water just before draining.

4

Make sauce in a jar

Combine lemon zest, lemon juice, five tablespoons olive oil, one third cup grated parmesan, two minced garlic cloves, one teaspoon mixed herbs, half teaspoon red pepper flakes, one teaspoon sugar, three quarters teaspoon salt, and half teaspoon black pepper in a jar. Add half cup reserved pasta water, secure lid and shake until the parmesan hydrates and the mixture emulsifies.

5

Combine and finish

Drain pasta and broccoli and return to the pot off the heat. Pour the jarred sauce over the pasta, add one cup shredded cheese and stir vigorously. Add more reserved pasta water as needed to loosen the sauce. Adjust seasoning and serve with extra parmesan.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 520kcal | Carbohydrates: 60g | Protein:
22g | Fat: 18g | Saturated Fat: 5g |
Polyunsaturated Fat: 4g | Monounsaturated Fat:
7g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@snapyrecipe on social media!

Broccoli Cheese Pasta Recipe — A Creamy, Cheesy Delight

Categories:

Broccoli Cheese Pasta Recipe — A Creamy, Cheesy Delight

Did You Make This?

Leave a comment & rating below or tag @snapyrecipe on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family Photo

Hi, I'm Natalia!

Chef and recipe creator specializing in delicious Comfort Food cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

Get My 30-Minute Meals email series!

Quick and easy dinner ideas delivered to your inbox.