30-MINUTE MEALS! Get the email series now
Royal Recipe

Autumn Naan Pizzas

5 from 1 vote
1 Comments
Natalia Reed
By: Natalia ReedUpdated: Aug 6, 2026
This post may contain affiliate links. Please read our disclosure policy.

A cozy, seasonal take on pizza using naan, pumpkin puree, caramelized shallots, sausage, fontina and ricotta finished with fresh sage and hot honey.

Autumn Naan Pizzas

This recipe is my answer to busy autumn evenings when I want dinner to feel special without a lot of fuss. I first combined these flavors on a crisp October night when pumpkins were stacked at the farmers market and I had a packet of naan in the pantry. The first bite was warm, creamy, and slightly sweet with a hint of heat from hot honey. It immediately became a repeat after-school dinner and later a weekend crowd-pleaser at a small family gathering. The contrast of the crispy edges of the naan with the soft, slightly sweet pumpkin base and pockets of molten fontina is what keeps people coming back for more.

What makes this version stand out is the balance of textures and seasons. The pumpkin puree lends a silky, earthy backdrop while caramelized shallots bring a deep sweet savor. Sausage offers savory richness and a slight chew that plays wonderfully against dollops of creamy ricotta. Fresh sage brushed with oil crisps up in the oven and releases autumn aromatics that smell like Thanksgiving in miniature. Every component is simple yet thoughtful, and the whole comes together in about 35 minutes from start to finish.

Why You'll Love This Recipe

  • Ready in roughly 35 minutes from start to finish, making it ideal for weeknights when you want something seasonal and impressive with minimal effort.
  • Uses pantry-friendly canned pumpkin and store-bought naan so you do not need to make dough from scratch but still get a homemade feel and texture.
  • Versatile toppings: swap pork sausage for turkey, chicken, or a plant-based option while keeping the same flavor profile and cook time.
  • Make-ahead components: caramelized shallots and cooked sausage reheat beautifully, so you can assemble quickly and bake when ready.
  • Great for entertaining because each naan is an individual portion and can be customized per guest preferences.
  • Balanced flavors with sweet, savory, creamy, and spicy notes that are universally appealing and especially comforting in cool weather.

I remember serving these at a small Sunday supper where neighbors dropped by with casseroles. Everyone loved the personal-size pizzas and the hot honey drizzle was a surprise hit. My nephew declared it the best pizza ever because of the sweet topping, and my partner loved that it felt like a grown up comfort meal. It has become my go-to when I want to make something seasonal without a lot of ceremony.

Ingredients

  • Naan breads: 4 pieces. Choose plain or garlic naan around 6 to 8 inches wide so edges crisp while centers stay soft. I like a store brand that is thin and pliable rather than very thick flatbreads.
  • Pumpkin puree: 1 cup canned pumpkin puree. Canned is consistent and gives that smooth texture; for a fresher taste use 1 cup homemade puree strained of excess water.
  • Ground sausage: 1 pound. I use mild pork sausage for richness. Turkey or chicken sausage are good leaner swaps; for vegetarian use a plant-based sausage crumble.
  • Caramelized shallots: 1 cup thinly sliced and caramelized. Shallots give a softer, sweeter note than regular onion. If you only have onions, use a medium yellow onion thinly sliced and caramelize until deep amber.
  • Dried oregano: 1 teaspoon. Adds earthy, herbal warmth. Italian seasoning works too if you prefer a multiherb profile.
  • Fontina cheese: 1 cup shredded. Fontina melts smoothly and develops a creamy, nutty character. Substitute young provolone or mozzarella if needed.
  • Whole-milk ricotta: 1 cup. Provides cool creamy pockets that contrast the warm melted cheese. For a richer finish use mascarpone or cream cheese blended until smooth.
  • Fresh sage leaves: 1 tablespoon whole leaves. Lightly brush with oil so they crisp in the oven and release aroma. Thyme or rosemary are fine alternatives.
  • Extra-virgin olive oil: 2 tablespoons total. Use one tablespoon for cooking the shallots and one tablespoon to dress the sage and finish the pizzas.
  • Hot honey: 2 tablespoons to drizzle. If you like a milder finish use regular honey, or mix honey with a small pinch of crushed red pepper for control over heat.

Instructions

Preheat the oven: Set the oven to 425 degrees F. Position the oven rack in the center so the naan crisps evenly without burning on the bottom. A hot oven is key to crisp edges and melted cheese in about 12 to 15 minutes. Caramelize the shallots: In a skillet over medium heat add 1 tablespoon of olive oil. Add thinly sliced shallots and a pinch of salt. Cook, stirring occasionally, for about 8 to 10 minutes until they are soft and deep golden brown. Lower the heat if the shallots brown too quickly; slow cooking brings out sweetness. Brown the sausage: Push the shallots to the side of the skillet or transfer them temporarily, then add the ground sausage. Break it up with a spatula and cook for 6 to 8 minutes until no pink remains and the bits develop browned edges. Drain excess fat on paper towels if the sausage is particularly greasy. Assemble the naan: Lay 4 naan breads on a large baking sheet. Spread about 1/4 cup of pumpkin puree evenly over each naan, leaving a 1/2 inch rim. Sprinkle 1/4 teaspoon dried oregano on each to layer the herb flavor under the cheese. Add cheeses and toppings: Scatter shredded fontina evenly across the pumpkin layer, then distribute the browned sausage and caramelized shallots. Place dollops of ricotta using a tablespoon; this creates cool creamy pockets as the pizzas bake. Scatter the sage leaves after brushing with a little oil so they crisp. Bake until golden: Transfer the baking sheet to the preheated oven and bake for about 12 to 15 minutes. Look for bubbling cheese and slightly darkened edges on the naan. If you want extra crispness, broil for 30 to 60 seconds watching closely so the toppings do not burn. Finish and serve: Remove from the oven and immediately drizzle about 1/2 tablespoon of hot honey over each naan. Let rest for 2 minutes, then slice or serve whole. The contrast of warm cheese and cool ricotta with the sweet heat is at its best right away. Autumn naan pizzas on a baking sheet with sage

You Must Know

  • This keeps well refrigerated for up to 3 days. Reheat in a 400 degree F oven on a rack for 6 to 8 minutes to restore crispness. Do not microwave unless you do not mind a softer crust.
  • Freezes well for up to 2 months if you wrap each naan tightly in plastic and foil. Thaw in the refrigerator before reheating in the oven.
  • High in protein because of the sausage and cheeses. Use turkey sausage and part-skim ricotta to reduce fat and calories.
  • If you need gluten free, use a certified gluten-free naan substitute and confirm brands for allergen safety.
  • Preparation time is about 15 minutes active work and 12 to 15 minutes in the oven for a total of roughly 30 to 35 minutes.

My favorite thing about this dish is how flexible it is. I have swapped out proteins, made a vegetarian batch for friends, and used it as a centerpiece for casual gatherings. Every iteration retained the heart of the dish because the pumpkin and ricotta combination is forgiving and delicious.

Close up of a slice with melting fontina and ricotta

Storage Tips

Cool leftover naan pizzas to room temperature no longer than two hours, then refrigerate in an airtight container layered with parchment to prevent sticking. Stored properly they maintain quality for up to 3 days. For freezing, wrap each naan in plastic wrap and then foil to prevent freezer burn and store in a zip bag or rigid container for up to 2 months. To reheat, place directly on an oven rack at 400 degrees F for 6 to 10 minutes until heated through and crisp. Avoid reheating at low temperatures which makes the crust soggy.

Ingredient Substitutions

For a vegetarian version omit the sausage and add roasted mushrooms or crumbled tempeh seasoned with smoked paprika. If you prefer less fat, choose turkey sausage and part-skim ricotta. Swap fontina for young mozzarella or provolone if fontina is not available. If you want more acidity, add a tablespoon of balsamic reduction after baking. For sweetness control swap hot honey for plain honey or maple syrup depending on your spice preference.

Serving Suggestions

Serve these on a large cutting board for family style sharing or plate individually with a crisp green salad dressed with lemon vinaigrette to cut through the richness. They pair nicely with a dry white wine like a Sauvignon Blanc or a light-bodied red such as Pinot Noir. For brunch, add a fried egg on top of each naan just before serving. Garnish with extra fresh sage or a light sprinkle of flaky sea salt for contrast.

Cultural Background

This take combines Mediterranean flatbread tradition with classic autumn produce. Naan has its roots in South Asian breads but has been widely adopted as a convenient personal flatbread in Western kitchens. Using pumpkin as a base leans into North American fall cooking where pumpkin is used in both sweet and savory applications. The result is a cross-cultural comfort dish that bridges pantry staples with seasonal produce.

Seasonal Adaptations

In late fall and winter, consider swapping pumpkin for roasted butternut squash puree and adding a pinch of ground nutmeg or cinnamon for warmth. In spring, replace pumpkin with a light ricotta-lemon spread and top with peas and tender asparagus. For summer evenings, use a thin tomato base with grilled sausage and fresh basil instead of sage. Each season allows small swaps that keep the technique while refreshing the flavor.

Meal Prep Tips

Make the caramelized shallots and cooked sausage in advance and store them in the refrigerator for up to 4 days. Pre-portion pumpkin puree into 1/4 cup scoops in a container so assembly is fast. Keep the cheeses separate and assemble just before baking so the crust stays crisp. For grab-and-go lunches, bake the naan, cool completely, wrap tightly and keep chilled; reheat in the oven at 400 degrees F for 6 minutes when ready to eat.

These autumn naan pizzas are a joyful, flexible dish that celebrates seasonal produce while remaining approachable. Whether for a cozy family dinner or a small gathering, they deliver warmth and flavor with minimal fuss. Try the variations and make it your own.

Pro Tips

  • Caramelize the shallots slowly over medium-low heat to develop maximum sweetness without burning.

  • Brush sage leaves lightly with oil so they crisp in the oven rather than becoming leathery.

  • Warm the pumpkin slightly before spreading if it is straight from the fridge so it spreads smoothly.

  • To keep the naan crisp when reheating, use the oven or a toaster oven instead of a microwave.

This nourishing autumn naan pizzas recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

Tags

Easy Dinnersrecipenaanpumpkinfall-recipesweeknight-dinnercheesypizzascomfort-food
No ratings yet

Autumn Naan Pizzas

This Autumn Naan Pizzas recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 4 steaks
Autumn Naan Pizzas
Prep:15 minutes
Cook:15 minutes
Rest Time:10 mins
Total:30 minutes

Ingredients

Base

Toppings

Cheesy goodness

Fresh finish

Instructions

1

Preheat the oven

Preheat oven to 425 degrees F and position rack in the center for even baking.

2

Caramelize shallots

In a skillet over medium heat add 1 tablespoon olive oil and cook thinly sliced shallots with a pinch of salt for 8 to 10 minutes until deep golden and soft.

3

Brown the sausage

Add ground sausage to the skillet, break it up and cook 6 to 8 minutes until browned and no pink remains. Drain excess fat if necessary.

4

Assemble the naan

Place 4 naan on a baking sheet and spread about 1/4 cup pumpkin puree on each, sprinkle 1/4 teaspoon oregano on each, then add shredded fontina, cooked sausage, and caramelized shallots.

5

Add ricotta and sage

Dot each naan with tablespoons of ricotta. Brush sage leaves with a little oil and scatter on top for crisp aromatic finish.

6

Bake until golden

Bake in the preheated oven for 12 to 15 minutes until cheese is melted and edges are golden. Broil 30 to 60 seconds if extra browning is desired, watching closely.

7

Finish with hot honey

Remove from oven and immediately drizzle about 1/2 tablespoon hot honey on each naan. Let rest 2 minutes and serve warm.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 580kcal | Carbohydrates: 45g | Protein:
28g | Fat: 30g | Saturated Fat: 9g |
Polyunsaturated Fat: 6g | Monounsaturated Fat:
12g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@snapyrecipe on social media!

Autumn Naan Pizzas

Categories:

Autumn Naan Pizzas

Did You Make This?

Leave a comment & rating below or tag @snapyrecipe on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family Photo

Hi, I'm Natalia!

Chef and recipe creator specializing in delicious Easy Dinners cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

Get My 30-Minute Meals email series!

Quick and easy dinner ideas delivered to your inbox.